HPA023739

NAPRT antibody from Sigma-Aldrich
NAPRT1, PP3856
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023739
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023739, RRID:AB_1854308
Product name
Anti-NAPRT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023739
Antibody type
Polyclonal
Antigen
Nicotinate phosphoribosyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLD
SGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVS
NNIDEEALARLAQEGSEVNVIGIGTSV
Storage
-20C
Provider Type Product Number
- No reagents -