Antibody data

Product number
H00027242-M23
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027242-M23, RRID:AB_1579934
Product name
TNFRSF21 monoclonal antibody (M23), clone 1B1
Provider product page
Abnova Corporation - H00027242-M23
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TNFRSF21.
Antigen sequence
MKCKAYTDCLSQNLVVIKPGTKETDNVCGTLPSFS
SSTSPSPGTAIFPRPEHMETHEVPSSTYVPKGMNS
TESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDV
NKTLPNLQVVNHQQGPHHRHILKLPPSMEATGGEK
SSTPIKGPKRGHPRQNLHKHFDINEHLPWMIVLFL
LLVLVVIVVCSIRKSSRTLKKGPRQDPSAIVEKAG
LKKSMTPTQNREKWIYYCNGHGIDILKLVAAQVGS
QWKDIYQFLCNASEREVAAFSNGYTADHERAYAAL
QHWTIRGPEASLAQLISALRQHRRNDVVEKIRGLM
EDTTQLETDKLALPMSPSPLSPSPIPSPNAKLENS
ALLTVEPSPQDKNKGFFVDESEPLLRCDSTSSGSS
ALSRNGSFITKEKKDTVLRQVRLDPCDLQPIFDDM
LHFLNPEELRVIEEIPQAEDKLDRLFEIIGVKSQE
ASQTLLDSVYSHLPDPL
Isotype
IgG
Antibody clone number
1B1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -