HPA014968

PLPPR1 antibody from Atlas Antibodies
FLJ20300, LPPR1, MGC26189, PRG-3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014968
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014968, RRID:AB_1855702
Product name
Anti-PLPPR1
Provider product page
Atlas Antibodies - HPA014968
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KSTRESLIAQEKTILTGECCYLNPLLRRIIRF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -