HPA015750

NEK4 antibody from Sigma-Aldrich
NRK2, pp12301, STK2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015750
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015750, RRID:AB_1854367
Product name
Anti-NEK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015750
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase Nek4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VAGECIIEKQGRIHPDLQPHNSGSEPSLSRQRRQK
RREQTEHRGEKRQVRRDLFAFQESPPRFLPSHPIV
GKVDVTSTQKEAENQRRVVTGSVSSSRSSEMSSSK
DRPLSARERRRLKQSQEEMSSSGPSVRKASLSVAG
PGKPQEEDQP
Storage
-20C
Provider Type Product Number
- No reagents -