HPA015750

NEK4 antibody from Atlas Antibodies
NRK2, pp12301, STK2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015750
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015750, RRID:AB_1854367
Product name
Anti-NEK4
Provider product page
Atlas Antibodies - HPA015750
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VAGECIIEKQGRIHPDLQPHNSGSEPSLSRQRRQK
RREQTEHRGEKRQVRRDLFAFQESPPRFLPSHPIV
GKVDVTSTQKEAENQRRVVTGSVSSSRSSEMSSSK
DRPLSARERRRLKQSQEEMSSSGPSVRKASLSVAG
PGKPQEEDQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -