HPA024035

HPGDS antibody from Atlas Antibodies
GSTS, GSTS1, GSTS1-1, H-PGDS, PGD2, PGDS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024035
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024035, RRID:AB_1855743
Product name
Anti-HPGDS
Provider product page
Atlas Antibodies - HPA024035
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLI
GNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTL
RKKVQAIPAVANWI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -