WH0023011M1

RAB21 antibody from MilliporeSigma / Merck KGaA
KIAA0118
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0023011M1
Provider
MilliporeSigma / Merck KGaA
Product name
Monoclonal Anti-RAB21 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0023011M1
Antibody type
Monoclonal
Antigen
RAB21 (NP_055814, a.a. 116-226) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
ELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESY
AESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQ
VDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGG
CCSSG* (without GST)
Isotype
IgG
Storage
-20C