Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023011-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023011-M03, RRID:AB_1112448
- Product name
- RAB21 monoclonal antibody (M03), clone 1G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAB21.
- Antigen sequence
ELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESY
AESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQ
VDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGG
CCSSG- Isotype
- IgG
- Antibody clone number
- 1G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Competitive binding of Rab21 and p120RasGAP to integrins regulates receptor traffic and migration.
Mai A, Veltel S, Pellinen T, Padzik A, Coffey E, Marjomäki V, Ivaska J
The Journal of cell biology 2011 Jul 25;194(2):291-306
The Journal of cell biology 2011 Jul 25;194(2):291-306
No comments: Submit comment
No validations: Submit validation data