HPA016988

RAB21 antibody from Sigma-Aldrich
KIAA0118
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016988
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016988, RRID:AB_1855998
Product name
Anti-RAB21 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016988
Antibody type
Polyclonal
Antigen
Ras-related protein Rab-21 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GAILVYDITDEDSFQKVKNWVKELRKMLGNEICLC
IVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSA
KQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQP
GTARRGVQIIDDEPQAQTS
Storage
-20C
Provider Type Product Number
- No reagents -