HPA012696

ITGA6 antibody from Sigma-Aldrich
CD49f
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012696
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012696, RRID:AB_1851822
Product name
Anti-ITGA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012696
Antibody type
Polyclonal
Antigen
Integrin alpha-6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFG
YSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVI
NIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCF
EYTANPAGYNPSISIVGTLEAEKERRKSGLSS
Storage
-20C
Provider Type Product Number
- No reagents -