Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012696 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012696, RRID:AB_1851822
- Product name
- Anti-ITGA6
- Antibody type
- Polyclonal
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFG
YSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVI
NIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCF
EYTANPAGYNPSISIVGTLEAEKERRKSGLSS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Multiplex flow cytometry barcoding and antibody arrays identify surface antigen profiles of primary and metastatic colon cancer cell lines.
Identification of integrins α6 and β7 as c-Jun- and transformation-relevant genes in highly invasive fibrosarcoma cells
Sukhdeo K, Paramban RI, Vidal JG, Elia J, Martin J, Rivera M, Carrasco DR, Jarrar A, Kalady MF, Carson CT, Balderas R, Hjelmeland AB, Lathia JD, Rich JN
PloS one 2013;8(1):e53015
PloS one 2013;8(1):e53015
Identification of integrins α6 and β7 as c-Jun- and transformation-relevant genes in highly invasive fibrosarcoma cells
Kielosto M, Nummela P, Järvinen K, Yin M, Hölttä E
International Journal of Cancer 2009 September;125(5):1065-1073
International Journal of Cancer 2009 September;125(5):1065-1073
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines A-431 and MCF-7 using Anti-ITGA6 antibody. Corresponding ITGA6 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human placenta and liver tissues using HPA012696 antibody. Corresponding ITGA6 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN