HPA024679

TONSL antibody from Sigma-Aldrich
IKBR, NFKBIL2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024679
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024679, RRID:AB_1854441
Product name
Anti-NFKBIL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024679
Antibody type
Polyclonal
Antigen
NF-kappa-B inhibitor-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WNRRNDMGETLLHRACIEGQLRRVQDLVRQGHPLN
PRDYCGWTPLHEACNYGHLEIVRFLLDHGAAVDDP
GGQGCEGITPLHDALNCGHFEVAELLLERGASVTL
RTRK
Storage
-20C
Provider Type Product Number
- No reagents -