Antibody data
- Product number
- HPA026720
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA026720, RRID:AB_1853685
- Product name
- Anti-MDH2
- Provider product page
- Atlas Antibodies - HPA026720
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MLSALARPASAALRRSFSTSAQNNAKVAVLGASGG
IGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSH
IETKAAVKGYLGPE
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image

- Experimental details
- Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-MDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver using Anti-MDH2 antibody HPA026720.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon using Anti-MDH2 antibody HPA026720.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human lymph node using Anti-MDH2 antibody HPA026720.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney using Anti-MDH2 antibody HPA026720.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-MDH2 antibody HPA026720 (A) shows similar protein distribution across tissues to independent antibody HPA019714 (B).
- Antibody #2 product nr
- HPA019716, HPA019848, HPA019714
- Antibody provider
- Atlas Antibodies
- Show more