Antibody data

Product number
H00004191-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004191-M03, RRID:AB_1137302
Product name
MDH2 monoclonal antibody (M03), clone 2B7
Provider product page
Abnova Corporation - H00004191-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MDH2.
Antigen sequence
EAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFG
VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGK
TIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVV
KAKAGAGS
Isotype
IgG
Antibody clone number
2B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -