HPA004752

ILKAP antibody from Atlas Antibodies
DKFZP434J2031, FLJ10181, PPM1O
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004752
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004752, RRID:AB_1234573
Product name
Anti-ILKAP
Provider product page
Atlas Antibodies - HPA004752
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSG
SLATSISQMVKTEGKGAKRKTSEEEKNGSEELVEK
KVCKASSVIFGLKGYVAERKGEREEMQDAHV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -