HPA004752

ILKAP antibody from Atlas Antibodies
DKFZP434J2031, FLJ10181, PPM1O
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004752
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004752, RRID:AB_1851753
Product name
Anti-ILKAP
Provider product page
Atlas Antibodies - HPA004752
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSG
SLATSISQMVKTEGKGAKRKTSEEEKNGSEELVEK
KVCKASSVIFGLKGYVAERKGEREEMQDAHV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -