HPA004752

ILKAP antibody from Sigma-Aldrich
DKFZP434J2031, FLJ10181, PPM1O
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004752
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004752, RRID:AB_1851753
Product name
Anti-ILKAP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004752
Antibody type
Polyclonal
Antigen
Integrin-linked kinase-associated serine/threonine phosphatase 2C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSG
SLATSISQMVKTEGKGAKRKTSEEEKNGSEELVEK
KVCKASSVIFGLKGYVAERKGEREEMQDAHV
Storage
-20C
Provider Type Product Number
- No reagents -