HPA004749

PDLIM3 antibody from Atlas Antibodies
ALP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004749
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004749, RRID:AB_1855150
Product name
Anti-PDLIM3
Provider product page
Atlas Antibodies - HPA004749
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGD
VILAIDGFGTESMTHADAQDRIKAAAHQLCLKIDR
GETHLWSPQVSEDGKA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -