Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406464 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-PDZ and LIM Domain 3 (PDLIM3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PDLIM3 antibody: synthetic peptide directed towards the N terminal of human PDLIM3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGS
KAAAA NLCPGDVILA- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mutations in PDLIM3 and MYOZ1 encoding myocyte Z line proteins are infrequently found in idiopathic dilated cardiomyopathy.
Arola AM, Sanchez X, Murphy RT, Hasle E, Li H, Elliott PM, McKenna WJ, Towbin JA, Bowles NE
Molecular genetics and metabolism 2007 Apr;90(4):435-40
Molecular genetics and metabolism 2007 Apr;90(4):435-40
No comments: Submit comment
No validations: Submit validation data