HPA004749

PDLIM3 antibody from Sigma-Aldrich
ALP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004749
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004749, RRID:AB_1855150
Product name
Anti-PDLIM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004749
Antibody type
Polyclonal
Antigen
PDZ and LIM domain protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGD
VILAIDGFGTESMTHADAQDRIKAAAHQLCLKIDR
GETHLWSPQVSEDGKA
Storage
-20C
Provider Type Product Number
- No reagents -