H00080712-A01

ESX1 antibody from Abnova Corporation
ESX1L, ESXR1
No application information provided.

Antibody data

Product number
H00080712-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00080712-A01, RRID:AB_535198
Product name
ESX1L polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00080712-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant ESX1L.
Antigen sequence
AEGPQTAEGPQPPERKRRRRTAFTQFQLQELENFF
DESQYPDVVARERLAARLNLTEDRVQVWFQNRRAK
WKRNQRVLMLRNTATADLAH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -