AV36220

ESX1 antibody from Sigma-Aldrich
ESX1L, ESXR1
No application information provided.

Antibody data

Product number
AV36220
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV36220, RRID:AB_1848272
Product name
Anti-ESX1 (AB1) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV36220
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ESX1 with an internal ID of P07575
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
LMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSD
DQDREGGGGHEPEQQ
Storage
-20C
Provider Type Product Number
- No reagents -