HPA023994

GSAP antibody from Sigma-Aldrich
LOC54103, PION
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023994
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023994, RRID:AB_1855386
Product name
Anti-PION antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023994
Antibody type
Polyclonal
Antigen
Protein pigeon homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSYWSVYSETSNMDKLLPHSSVLTWNTEIPGITLV
TEDIALPLMKVLSFKGYWEKLNSNLEYVKYAKPHF
HYNNSVVRREWHNLISEE
Storage
-20C
Provider Type Product Number
- No reagents -