HPA004938

PTGDS antibody from Sigma-Aldrich
L-PGDS, PGDS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004938
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004938, RRID:AB_1855745
Product name
Anti-PGDS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004938
Antibody type
Polyclonal
Antigen
Prostaglandin-H2 D-isomerase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKN
QCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVE
TDYDQYALLYSQGSKGPGEDFRMATLYSRTQT
Storage
-20C
Provider Type Product Number
- No reagents -