Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- LS-C388902 - Provider product page
- Provider
- LSBio
- Product name
- Anti-MMP3 Antibody (aa410-439) LS-C388902
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide from the C-terminal of human MMP3 (RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA, aa410-439 of NP_002413.1). Percent identity by BLAST analysis: Human (100%); Cat, Horse, Dog (90%); Ferret (83%); Bovine, Rabbit, Pig (80%); Mouse (63%); Rat (60%).
- Description
- Immunoaffinity purified
- Reactivity
- Human
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- 0.2ml
- Storage
- Prior to reconstitution, +4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data