Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R31680 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- MMP3 Antibody
- Antibody type
- Polyclonal
- Antigen
- An amino acid sequence from the C-terminal of human MMP3 (RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA) was used as the immunogen for this MMP3 antibody.
- Description
- Antigen affinity purified antibody
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the MMP3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of MMP3 antibody and Lane 1: human placenta; 2: U20S; 3: HeLa; 4: PANC; 5: COLO320
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of MMP3 antibody and recombinant human protein (0.5ng)