HPA029430

CHRNA3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029430
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA029430, RRID:AB_10603785
Product name
Anti-CHRNA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA029430
Antibody type
Polyclonal
Antigen
cholinergic receptor, nicotinic, alpha 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGN
AQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDG
MCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLS
ALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKY
VAM
Storage
-20C
Provider Type Product Number
- No reagents -