HPA019587

UPF1 antibody from Atlas Antibodies
HUPF1, KIAA0221, NORF1, pNORF1, RENT1, smg-2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA019587
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019587, RRID:AB_1856174
Product name
Anti-UPF1
Provider product page
Atlas Antibodies - HPA019587
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDA
YQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWD
LGLNKKRIAYFTLPKTD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -