HPA020857

UPF1 antibody from Atlas Antibodies
HUPF1, KIAA0221, NORF1, pNORF1, RENT1, smg-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020857
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020857, RRID:AB_1856175
Product name
Anti-UPF1
Provider product page
Atlas Antibodies - HPA020857
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWK
STSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVE
DVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRP
LS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -