R32296

UPF1 antibody from NSJ Bioreagents
HUPF1, KIAA0221, NORF1, pNORF1, RENT1, smg-2

Antibody data

Product number
R32296
Provider
NSJ Bioreagents
Product name
RENT1 / hUPF1 Antibody
Provider product page
NSJ Bioreagents - R32296
Antibody type
Polyclonal
Antigen
Amino acids NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE of human UPF1 were used as the immunogen for the UPF1 antibody.
Description
Antigen affinity
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Vial size
100 µg
Concentration
Lyophilized; resuspend with 200 ul for 0.5 mg/ml
Storage
After reconstitution, the UPF1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -