HPA020857

UPF1 antibody from Sigma-Aldrich
HUPF1, KIAA0221, NORF1, pNORF1, RENT1, smg-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020857
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020857, RRID:AB_1856175
Product name
Anti-UPF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020857
Antibody type
Polyclonal
Antigen
Regulator of nonsense transcripts 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWK
STSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVE
DVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRP
LS
Storage
-20C
Provider Type Product Number
- No reagents -