Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006881 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006881, RRID:AB_1078392
- Product name
- Anti-NDRG1
- Antibody type
- Polyclonal
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
INVNPCAEGWMDWAASKISGWTQALPDMVVSHLFG
KEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYN
SRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVD
AVVECNSKLDPTKTTLL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The metastasis suppressor, N-myc downregulated gene 1 (NDRG1), is a prognostic biomarker for human colorectal cancer.
N-myc downstream regulated 1 (NDRG1) is regulated by eukaryotic initiation factor 3a (eIF3a) during cellular stress caused by iron depletion.
A deletion in the N-myc downstream regulated gene 1 (NDRG1) gene in Greyhounds with polyneuropathy.
NDRG4 is required for cell cycle progression and survival in glioblastoma cells.
Mao Z, Sun J, Feng B, Ma J, Zang L, Dong F, Zhang D, Zheng M
PloS one 2013;8(7):e68206
PloS one 2013;8(7):e68206
N-myc downstream regulated 1 (NDRG1) is regulated by eukaryotic initiation factor 3a (eIF3a) during cellular stress caused by iron depletion.
Lane DJ, Saletta F, Suryo Rahmanto Y, Kovacevic Z, Richardson DR
PloS one 2013;8(2):e57273
PloS one 2013;8(2):e57273
A deletion in the N-myc downstream regulated gene 1 (NDRG1) gene in Greyhounds with polyneuropathy.
Drögemüller C, Becker D, Kessler B, Kemter E, Tetens J, Jurina K, Jäderlund KH, Flagstad A, Perloski M, Lindblad-Toh K, Matiasek K
PloS one 2010 Jun 22;5(6):e11258
PloS one 2010 Jun 22;5(6):e11258
NDRG4 is required for cell cycle progression and survival in glioblastoma cells.
Schilling SH, Hjelmeland AB, Radiloff DR, Liu IM, Wakeman TP, Fielhauer JR, Foster EH, Lathia JD, Rich JN, Wang XF, Datto MB
The Journal of biological chemistry 2009 Sep 11;284(37):25160-9
The Journal of biological chemistry 2009 Sep 11;284(37):25160-9
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines HEK293 and MCF-7 using Anti-NDRG1 antibody. Corresponding NDRG1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human prostate and skeletal muscle tissues using HPA006881 antibody. Corresponding NDRG1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no membranous positivity in myocytes as expected.
- Sample type
- HUMAN