HPA006881

NDRG1 antibody from Atlas Antibodies
CAP43, DRG1, NDR1, RTP, TDD5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006881
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006881, RRID:AB_888792
Product name
Anti-NDRG1
Provider product page
Atlas Antibodies - HPA006881
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
INVNPCAEGWMDWAASKISGWTQALPDMVVSHLFG
KEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYN
SRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVD
AVVECNSKLDPTKTTLL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -