HPA006881

NDRG1 antibody from Sigma-Aldrich
CAP43, DRG1, NDR1, RTP, TDD5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006881
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006881, RRID:AB_1078392
Product name
Anti-NDRG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006881
Antibody type
Polyclonal
Antigen
Protein NDRG1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
INVNPCAEGWMDWAASKISGWTQALPDMVVSHLFG
KEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYN
SRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVD
AVVECNSKLDPTKTTLL
Storage
-20C
Provider Type Product Number
- No reagents -