HPA023846

DMTF1 antibody from MilliporeSigma / Merck KGaA
DMP1, DMTF, hDMP1, MRUL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023846
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023846, RRID:AB_1847779
Product name
Anti-DMTF1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023846
Antibody type
Polyclonal
Antigen
Cyclin-D-binding Myb-like transcription factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASPTVTLTAAAPASPEQIIVHALSPEHLLNTSDNV
TVQCHTPRVIIQTVATEDITSSISQAELTVDSDIQ
SSDFPEPPDALEADTFPDEIHHPKMTVEPSFNDAH
VSKFSDQNSTELMNSVMVRTEEEI
Storage
-20C
Provider Type Product Number
- No reagents -