H00000623-M04

BDKRB1 antibody from Abnova Corporation
B1BKR, BKR1, bradyb1

Antibody data

Product number
H00000623-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000623-M04, RRID:AB_1571684
Product name
BDKRB1 monoclonal antibody (M04), clone 3A2
Provider product page
Abnova Corporation - H00000623-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant BDKRB1.
Antigen sequence
LASSWPPLELQSSNQSQLFPQNATACDNAPEAWDL
LHRVLPTFIISICFFGLLGNLFVLLVFLLPRRQLN
VAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPF
GALLCRVINGVIKANLFISIFLVVAISQDRYRVLV
HPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLL
RSIQAVPDLNITACILLLPHEAWHFARIVELNILG
FLLPLAAIVFFNYHILASLRTREEVSRTRCGGRKD
SKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQA
VRGCFWEDFIDLGLQLANFFAFTNSSLNPVIYVFV
GRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLF
WRN
Isotype
IgG
Antibody clone number
3A2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -