Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310194 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Argininosuccinate Lyase (ASL) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ASL antibody: synthetic peptide directed towards the middle region of human ASL
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLE
LIRSK AGRVFGREDK- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel stop codon mutation (X465Y) in the argininosuccinate lyase gene in a patient with argininosuccinic aciduria.
Tanaka T, Nagao M, Mori T, Tsutsumi H
The Tohoku journal of experimental medicine 2002 Oct;198(2):119-24
The Tohoku journal of experimental medicine 2002 Oct;198(2):119-24
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- WB Suggested Anti-ASL Antibody Titration: 5.0 μg/mL Positive Control: Human Liver