HPA007314

GRP antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007314
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007314, RRID:AB_1850354
Product name
Anti-GRP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007314
Antibody type
Polyclonal
Antigen
Gastrin-releasing peptide precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEE
AARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSE
DSSNFKDVGSKGKVGRLSAPGSQREGRNP
Storage
-20C
Provider Type Product Number
- No reagents -