HPA006900

PTPRN2 antibody from Atlas Antibodies
IA-2beta, ICAAR, KIAA0387, phogrin
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006900
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006900, RRID:AB_1079715
Product name
Anti-PTPRN2
Provider product page
Atlas Antibodies - HPA006900
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALP
FARPLDMERKKSEHPESSLSSEEETAGVENVKSQT
YSKDLLGQQPHSEPGAAAFGELQNQMPGPSKEEQS
LPAGAQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -