HPA026656

PTPRN2 antibody from Sigma-Aldrich
IA-2beta, ICAAR, KIAA0387, phogrin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026656
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026656, RRID:AB_1855912
Product name
Anti-PTPRN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026656
Antibody type
Polyclonal
Antigen
Receptor-type tyrosine-protein phosphatase N2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RFSESILTYVAHTSALTYPPGSRTQLREDLLPRTL
GQLQPDELSPKVDSGVDRHHLMAALSAYAAQRPPA
PPGEGSLEPQYLLRAPSRMPRPLLAPAAPQKWPSP
LGDSEDPSST
Storage
-20C
Provider Type Product Number
- No reagents -