H00051207-A01

DUSP13 antibody from Abnova Corporation
BEDP, DUSP13A, DUSP13B, FLJ32450, TMDP
No application information provided.

Antibody data

Product number
H00051207-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051207-A01, RRID:AB_1139197
Product name
DUSP13 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00051207-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant DUSP13.
Antigen sequence
MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLL
WVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQL
GITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEAD
DNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAM
GVSRSATLVLAFLMIYENMTLVEAIQTVQAHRNIC
PNSGFLRQLQVLDNRLGRETGRF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -