HPA024162

DUSP13 antibody from Sigma-Aldrich
BEDP, DUSP13A, DUSP13B, FLJ32450, TMDP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024162
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024162, RRID:AB_1847886
Product name
Anti-DUSP13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024162
Antibody type
Polyclonal
Antigen
Dual specificity protein phosphatase 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRACYSIWLLLAPTPPLSHCLQSPQKQHQVCGDRR
LKAGSTNCPSEKCTAWARYSHRMDSLQKQDLRRPK
IHGAVQASPYQPPTLASLQRLLWVRQ
Storage
-20C
Provider Type Product Number
- No reagents -