HPA019773

AKAP13 antibody from Atlas Antibodies
AKAP-Lbc, ARHGEF13, BRX, c-lbc, HA-3, Ht31, LBC, PROTO-LB
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019773
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019773, RRID:AB_1844686
Product name
Anti-AKAP13
Provider product page
Atlas Antibodies - HPA019773
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ARELKEQLHQKDQKILLLLEEKEMIFRDMAECSTP
LPEDCSPTHSPRVLFRSNTEEALKGGPLMKSAINE
VEILQGLVSGNLGGTLGPTVSSPIEQDVVGPVSLP
R
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -