HPA019773

AKAP13 antibody from Sigma-Aldrich
AKAP-Lbc, ARHGEF13, BRX, c-lbc, HA-3, Ht31, LBC, PROTO-LB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019773
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019773, RRID:AB_1844686
Product name
Anti-AKAP13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019773
Antibody type
Polyclonal
Antigen
A-kinase anchor protein 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ARELKEQLHQKDQKILLLLEEKEMIFRDMAECSTP
LPEDCSPTHSPRVLFRSNTEEALKGGPLMKSAINE
VEILQGLVSGNLGGTLGPTVSSPIEQDVVGPVSLP
R
Storage
-20C
Provider Type Product Number
- No reagents -