HPA022155

KRIT1 antibody from Sigma-Aldrich
CAM, CCM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022155
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022155, RRID:AB_1852636
Product name
Anti-KRIT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022155
Antibody type
Polyclonal
Antigen
Krev interaction trapped protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAA
FFTGQIFTKASPSNHKVIPVYVGVNIKGLHLLNME
TKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSF
IVHTKQAGLVVKLLMKL
Storage
-20C
Provider Type Product Number
- No reagents -