Antibody data

Product number
H00000944-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000944-M01A, RRID:AB_1016735
Product name
TNFSF8 monoclonal antibody (M01A), clone 2E11
Provider product page
Abnova Corporation - H00000944-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TNFSF8.
Antigen sequence
NNSVDLKLELLINKHIKKQALVTVCESGMQTKHVY
QNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLE
NVLSIFLYSNSD
Isotype
IgM
Antibody clone number
2E11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -