WH0000944M1

TNFSF8 antibody from MilliporeSigma / Merck KGaA
CD153, CD30LG
ELISA
Recommended by provider

Antibody data

Product number
WH0000944M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0000944M1, RRID:AB_1840526
Product name
Monoclonal Anti-TNFSF8 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0000944M1
Antibody type
Monoclonal
Antigen
TNFSF8 (NP_001235, a.a. 153-235) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
ascites fluid
Reactivity
Human
Antigen sequence
NNSVDLKLELLINKHIKKQALVTVCESGMQTKHVY
QNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLE
NVLSIFLYSNSD* (without GST)
Isotype
IgM
Storage
-20C
Provider Type Product Number
- No reagents -