HPA030342

MEN1 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030342
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030342, RRID:AB_10610138
Product name
Anti-MEN1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030342
Antibody type
Polyclonal
Antigen
multiple endocrine neoplasia I recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRN
RNVREALQAWADTATVIQDYNYCREDEEIYKEFFE
VANDVIPNLL
Storage
-20C
Provider Type Product Number
- No reagents -