Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00022954-M09 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00022954-M09, RRID:AB_714898
- Product name
- TRIM32 monoclonal antibody (M09), clone 2E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRIM32.
- Antigen sequence
RRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVK
EAAEERRRDFGEKLTRLRELMGELQRRKAALEGVS
KDLQARYKAVLQEYGHEERRVQDELARSRK- Isotype
- IgG
- Antibody clone number
- 2E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references TRIM32 modulates pluripotency entry and exit by directly regulating Oct4 stability.
Polarized and Stage-Dependent Distribution of Immunoreactivity for Novel PDZ-Binding Protein Preso1 in Adult Neurogenic Regions.
TRIM32 regulates skeletal muscle stem cell differentiation and is necessary for normal adult muscle regeneration.
Nuclear factor kappa B signaling initiates early differentiation of neural stem cells.
TRIM32 promotes neural differentiation through retinoic acid receptor-mediated transcription.
The TRIM-NHL protein TRIM32 activates microRNAs and prevents self-renewal in mouse neural progenitors.
Bahnassawy L, Perumal TM, Gonzalez-Cano L, Hillje AL, Taher L, Makalowski W, Suzuki Y, Fuellen G, del Sol A, Schwamborn JC
Scientific reports 2015 Aug 26;5:13456
Scientific reports 2015 Aug 26;5:13456
Polarized and Stage-Dependent Distribution of Immunoreactivity for Novel PDZ-Binding Protein Preso1 in Adult Neurogenic Regions.
Lee ES, Kim WR, Kim Y, Lee HW, Kim H, Sun W
Endocrinology and metabolism (Seoul, Korea) 2014 Sep;29(3):349-55
Endocrinology and metabolism (Seoul, Korea) 2014 Sep;29(3):349-55
TRIM32 regulates skeletal muscle stem cell differentiation and is necessary for normal adult muscle regeneration.
Nicklas S, Otto A, Wu X, Miller P, Stelzer S, Wen Y, Kuang S, Wrogemann K, Patel K, Ding H, Schwamborn JC
PloS one 2012;7(1):e30445
PloS one 2012;7(1):e30445
Nuclear factor kappa B signaling initiates early differentiation of neural stem cells.
Zhang Y, Liu J, Yao S, Li F, Xin L, Lai M, Bracchi-Ricard V, Xu H, Yen W, Meng W, Liu S, Yang L, Karmally S, Liu J, Zhu H, Gordon J, Khalili K, Srinivasan S, Bethea JR, Mo X, Hu W
Stem cells (Dayton, Ohio) 2012 Mar;30(3):510-24
Stem cells (Dayton, Ohio) 2012 Mar;30(3):510-24
TRIM32 promotes neural differentiation through retinoic acid receptor-mediated transcription.
Sato T, Okumura F, Kano S, Kondo T, Ariga T, Hatakeyama S
Journal of cell science 2011 Oct 15;124(Pt 20):3492-502
Journal of cell science 2011 Oct 15;124(Pt 20):3492-502
The TRIM-NHL protein TRIM32 activates microRNAs and prevents self-renewal in mouse neural progenitors.
Schwamborn JC, Berezikov E, Knoblich JA
Cell 2009 Mar 6;136(5):913-25
Cell 2009 Mar 6;136(5):913-25
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TRIM32 expression in transfected 293T cell line by TRIM32 monoclonal antibody (M09), clone 2E5.Lane 1: TRIM32 transfected lysate(72 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TRIM32 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TRIM32 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol