H00022954-B01P

TRIM32 antibody from Abnova Corporation
BBS11, HT2A, LGMD2H, TATIP

Antibody data

Product number
H00022954-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022954-B01P, RRID:AB_1581503
Product name
TRIM32 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00022954-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TRIM32 protein.
Antigen sequence
MAAAAASHLNLDALREVLECPICMESFTEEQLRPK
LLHCGHTICRQCLEKLLASSINGVRCPFCSKITRI
TSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGR
RLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKE
AAEERRRDFGEKLTRLRELMGELQRRKAALEGVSK
DLQARYKAVLQEYGHEERRVQDELARSRKFFTGSL
AEVEKSNSQVVEEQSYLLNIAEVQAVSRCDYFLAK
IKQADVALLEETADEEEPELTASLPRELTLQDVEL
LKVGHVGPLQIGQAVKKPRTVNVEDSWAMEATASA
ASTSVTFREMDMSPEEVVASPRASPAKQRGPEAAS
NIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQGEV
LVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS
FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVY
TLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEG
GKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEG
TVYFTQGLGLNLENRQNEHHLEGGFSIGSVGPDGQ
LGRQISHFFSENEDFRCIAGMCVDARGDLIVADSS
RKEILHFPKGGGYSVLIREGLTCPVGIALTPKGQL
LVLDCWDHCIKIYSYHLRRYSTP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -