Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182403 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tripartite Motif Containing 32 (TRIM32) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCV
DARGD LIVADSSRKE- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Homozygosity mapping with SNP arrays identifies TRIM32, an E3 ubiquitin ligase, as a Bardet-Biedl syndrome gene (BBS11).
Chiang AP, Beck JS, Yen HJ, Tayeh MK, Scheetz TE, Swiderski RE, Nishimura DY, Braun TA, Kim KY, Huang J, Elbedour K, Carmi R, Slusarski DC, Casavant TL, Stone EM, Sheffield VC
Proceedings of the National Academy of Sciences of the United States of America 2006 Apr 18;103(16):6287-92
Proceedings of the National Academy of Sciences of the United States of America 2006 Apr 18;103(16):6287-92
No comments: Submit comment
No validations: Submit validation data