Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183741 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tripartite Motif Containing 32 (TRIM32) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the N terminal of human TRIM32
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MAAAAASHLNLDALREVLECPICMESFTEEQLRPK
LLHCG HTICRQCLEK- Vial size
- 0.1 mg
Submitted references Tripartite motif ligases catalyze polyubiquitin chain formation through a cooperative allosteric mechanism.
Deficiency of the E3 ubiquitin ligase TRIM32 in mice leads to a myopathy with a neurogenic component.
Homozygosity mapping with SNP arrays identifies TRIM32, an E3 ubiquitin ligase, as a Bardet-Biedl syndrome gene (BBS11).
Streich FC Jr, Ronchi VP, Connick JP, Haas AL
The Journal of biological chemistry 2013 Mar 22;288(12):8209-21
The Journal of biological chemistry 2013 Mar 22;288(12):8209-21
Deficiency of the E3 ubiquitin ligase TRIM32 in mice leads to a myopathy with a neurogenic component.
Kudryashova E, Wu J, Havton LA, Spencer MJ
Human molecular genetics 2009 Apr 1;18(7):1353-67
Human molecular genetics 2009 Apr 1;18(7):1353-67
Homozygosity mapping with SNP arrays identifies TRIM32, an E3 ubiquitin ligase, as a Bardet-Biedl syndrome gene (BBS11).
Chiang AP, Beck JS, Yen HJ, Tayeh MK, Scheetz TE, Swiderski RE, Nishimura DY, Braun TA, Kim KY, Huang J, Elbedour K, Carmi R, Slusarski DC, Casavant TL, Stone EM, Sheffield VC
Proceedings of the National Academy of Sciences of the United States of America 2006 Apr 18;103(16):6287-92
Proceedings of the National Academy of Sciences of the United States of America 2006 Apr 18;103(16):6287-92
No comments: Submit comment
No validations: Submit validation data